Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C1orf48 polyclonal antibody (A01)

  • Catalog # : H00025936-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant C1orf48.
  • Immunogen:
  • C1orf48 (NP_056286, 182 a.a. ~ 279 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KEISEAMKSLPALIEQGEGFSQVLRMQPVIHLQRIHQEVFSSCHRKPDAKPENFITQIETTPTETASRKTSDVVLKRKQTKDCPQRKWYPLRPKKINL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00025936-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • NSL1
  • Gene Alias:
  • C1orf48,DC8,DKFZp566O1646,MIS14
  • Gene Description:
  • NSL1, MIND kinetochore complex component, homolog (S. cerevisiae)
  • Gene Summary:
  • This gene encodes a protein with two coiled-coil domains that localizes to kinetochores, which are chromosome-associated structures that attach to microtubules and mediate chromosome movements during cell division. The encoded protein is part of a conserved protein complex that includes two chromodomain-containing proteins and a component of the outer plate of the kinetochore. This protein complex is proposed to bridge centromeric heterochromatin with the outer kinetochore structure. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • NSL1, MIND kinetochore complex component,OTTHUMP00000034928
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook