Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MTHFD1L (Human) Recombinant Protein (Q01)

  • Catalog # : H00025902-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MTHFD1L partial ORF ( NP_056255, 801 a.a. - 899 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00025902-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • MTHFD1L
  • Gene Alias:
  • DKFZp586G1517,FLJ21145,FTHFSDC1,MTC1THFS,dJ292B18.2
  • Gene Description:
  • methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
  • Gene Summary:
  • One-carbon substituted forms of tetrahydrofolate (THF) are involved in the de novo synthesis of purines and thymidylate and support cellular methylation reactions through the regeneration of methionine from homocysteine. MTHFD1L is an enzyme involved in THF synthesis in mitochondria (Christensen et al., 2005 [PubMed 15611115]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000017418,formyltetrahydrofolate synthetase domain containing 1,mitochondrial C1-tetrahydrofolate synthase,mitochondrial C1-tetrahydrofolate synthetase
  • RSS
  • YouTube
  • Linkedin
  • Facebook