Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HOM-TES-103 (Human) Recombinant Protein (P01)

  • Catalog # : H00025900-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HOM-TES-103 full-length ORF ( NP_542769.2, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 49.3
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00025900-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • IFFO1
  • Gene Alias:
  • DKFZp586I2223,FLJ20703,HOM-TES-103,IFFO,MGC117359
  • Gene Description:
  • intermediate filament family orphan 1
  • Gene Summary:
  • This gene is a member of the intermediate filament family. Intermediate filaments are proteins which are primordial components of the cytoskeleton and nuclear envelope. The proteins encoded by the members of this gene family are evolutionarily and structurally related but have limited sequence homology, with the exception of the central rod domain. Alternative splicing has been observed for this gene and three transcript variants encoding different isoforms have been identified. Other alternatively spliced transcripts may exist, but their biological validity has not been confirmed. [provided by RefSeq
  • Other Designations:
  • HOM-TES-103 tumor antigen-like,intermediate filament family orphan,intermediate filament-like MGC:2625
  • RSS
  • YouTube
  • Linkedin
  • Facebook