Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IFFO1 mouse monoclonal antibody (hybridoma)

  • Catalog # : H00025900-M
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant IFFO1.
  • Immunogen:
  • IFFO1 (NP_542769.2, 1 a.a. ~ 200 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactivity and specificity confirmed by ELISA and Western Blot.
  • Note:
  • Customer should check the viability of the hybridomas within one month from the date of receipt. Fee-for-service of long term hybridoma storage can be performed upon customer's request.
  • Deliverables:
  • Up to 5 positive hybridoma clones will be delivered to customer in the cryotube format.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • IFFO1
  • Gene Alias:
  • DKFZp586I2223,FLJ20703,HOM-TES-103,IFFO,MGC117359
  • Gene Description:
  • intermediate filament family orphan 1
  • Gene Summary:
  • This gene is a member of the intermediate filament family. Intermediate filaments are proteins which are primordial components of the cytoskeleton and nuclear envelope. The proteins encoded by the members of this gene family are evolutionarily and structurally related but have limited sequence homology, with the exception of the central rod domain. Alternative splicing has been observed for this gene and three transcript variants encoding different isoforms have been identified. Other alternatively spliced transcripts may exist, but their biological validity has not been confirmed. [provided by RefSeq
  • Other Designations:
  • HOM-TES-103 tumor antigen-like,intermediate filament family orphan,intermediate filament-like MGC:2625
  • RSS
  • YouTube
  • Linkedin
  • Facebook