HOM-TES-103 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of IFFO1 expression in transfected 293T cell line (H00025900-T01) by IFFO1 MaxPab polyclonal antibody.
Lane 1: HOM-TES-103 transfected lysate(22 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HOM-TES-103 protein.
Immunogen
HOM-TES-103 (NP_542769.2, 1 a.a. ~ 200 a.a) full-length human protein.
Sequence
MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IFFO1 expression in transfected 293T cell line (H00025900-T01) by IFFO1 MaxPab polyclonal antibody.
Lane 1: HOM-TES-103 transfected lysate(22 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IFFO1
Entrez GeneID
25900GeneBank Accession#
NM_080731.2Protein Accession#
NP_542769.2Gene Name
IFFO1
Gene Alias
DKFZp586I2223, FLJ20703, HOM-TES-103, IFFO, MGC117359
Gene Description
intermediate filament family orphan 1
Omim ID
610495Gene Ontology
HyperlinkGene Summary
This gene is a member of the intermediate filament family. Intermediate filaments are proteins which are primordial components of the cytoskeleton and nuclear envelope. The proteins encoded by the members of this gene family are evolutionarily and structurally related but have limited sequence homology, with the exception of the central rod domain. Alternative splicing has been observed for this gene and three transcript variants encoding different isoforms have been identified. Other alternatively spliced transcripts may exist, but their biological validity has not been confirmed. [provided by RefSeq
Other Designations
HOM-TES-103 tumor antigen-like|intermediate filament family orphan|intermediate filament-like MGC:2625
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com