SUMF2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SUMF2 polyclonal antibody (A01), Lot # 060619JCS1 Western Blot analysis of SUMF2 expression in HepG2 ( Cat # L019V1 ).
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SUMF2.
Immunogen
SUMF2 (NP_056226, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
Sequence
QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (77)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SUMF2 polyclonal antibody (A01), Lot # 060619JCS1 Western Blot analysis of SUMF2 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — SUMF2
Entrez GeneID
25870GeneBank Accession#
NM_015411Protein Accession#
NP_056226Gene Name
SUMF2
Gene Alias
DKFZp566I1024, DKFZp686I1024, DKFZp686L17160, DKFZp781L1035, MGC99485, pFGE
Gene Description
sulfatase modifying factor 2
Omim ID
607940Gene Ontology
HyperlinkGene Summary
The catalytic sites of sulfatases are only active if they contain a unique amino acid, C-alpha-formylglycine (FGly). The FGly residue is posttranslationally generated from a cysteine by enzymes with FGly-generating activity. The gene described in this record is a member of the sulfatase-modifying factor family and encodes a protein with a DUF323 domain that localizes to the lumen of the endoplasmic reticulum. This protein has low levels of FGly-generating activity but can heterodimerize with another family member - a protein with high levels of FGly-generating activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
C-alpha-formyglycine-generating enzyme 2|paralog of the formylglycine-generating enzyme
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com