SULT4A1 monoclonal antibody (M02), clone 3C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SULT4A1 expression in transfected 293T cell line by SULT4A1 monoclonal antibody (M02), clone 3C1.
Lane 1: SULT4A1 transfected lysate(33 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SULT4A1 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SULT4A1.
Immunogen
SULT4A1 (NP_055166.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SULT4A1 expression in transfected 293T cell line by SULT4A1 monoclonal antibody (M02), clone 3C1.
Lane 1: SULT4A1 transfected lysate(33 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SULT4A1 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — SULT4A1
Entrez GeneID
25830GeneBank Accession#
NM_014351Protein Accession#
NP_055166.1Gene Name
SULT4A1
Gene Alias
BR-STL-1, BRSTL1, DJ388M5.3, MGC40032, NST, SULTX3, hBR-STL-1
Gene Description
sulfotransferase family 4A, member 1
Omim ID
608359Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia. [provided by RefSeq
Other Designations
OTTHUMP00000028875|brain sulphotransferase-like|nervous system cytosolic sulfotransferase|sulfotransferase-related protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com