Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BACE2 polyclonal antibody (A01)

  • Catalog # : H00025825-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BACE2.
  • Immunogen:
  • BACE2 (NP_036237, 306 a.a. ~ 395 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00025825-A01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • BACE2
  • Gene Alias:
  • AEPLC,ALP56,ASP1,ASP21,BAE2,CDA13,CEAP1,DRAP
  • Gene Description:
  • beta-site APP-cleaving enzyme 2
  • Gene Summary:
  • Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • 56 kDa aspartic-like protease,Down syndrome region aspartic protease,aspartyl protease 1,beta secretase 2,beta-site amyloid beta A4 precursor protein-cleaving enzyme 2,memapsin-1,membrane-associated aspartic protease 1,transmembrane aspartic proteinase As
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook