Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRDX5 (Human) Recombinant Protein (P01)

  • Catalog # : H00025824-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRDX5 full-length ORF ( NP_036226.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48.4
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00025824-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PRDX5
  • Gene Alias:
  • ACR1,AOEB166,B166,MGC117264,MGC142283,MGC142285,PLP,PMP20,PRDX6,PRXV,SBBI10
  • Gene Description:
  • peroxiredoxin 5
  • Gene Summary:
  • This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • Alu co-repressor 1,TPx type VI,antioxidant enzyme B166,liver tissue 2D-page spot 71B,peroxisomal antioxidant enzyme,thioredoxin peroxidase PMP20
  • RSS
  • YouTube
  • Linkedin
  • Facebook