Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRDX5 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00025824-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human PRDX5 protein.
  • Immunogen:
  • PRDX5 (NP_036226.1, 1 a.a. ~ 214 a.a) full-length human protein.
  • Sequence:
  • MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of PRDX5 transfected lysate using anti-PRDX5 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PRDX5 MaxPab mouse polyclonal antibody (B01) (H00025824-B01).
  • PDF DownloadProtocol Download
  • Application Image
  • Gene Information
  • Gene Name:
  • PRDX5
  • Gene Alias:
  • ACR1,AOEB166,B166,MGC117264,MGC142283,MGC142285,PLP,PMP20,PRDX6,PRXV,SBBI10
  • Gene Description:
  • peroxiredoxin 5
  • Gene Summary:
  • This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • Alu co-repressor 1,TPx type VI,antioxidant enzyme B166,liver tissue 2D-page spot 71B,peroxisomal antioxidant enzyme,thioredoxin peroxidase PMP20
  • RSS
  • YouTube
  • Linkedin
  • Facebook