CCRN4L (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CCRN4L partial ORF ( NP_036250, 64 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTHPPIRVMQWNILA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.53
Interspecies Antigen Sequence
Mouse (89); Rat (89)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CCRN4L
Entrez GeneID
25819GeneBank Accession#
NM_012118Protein Accession#
NP_036250Gene Name
CCRN4L
Gene Alias
CCR4L, MGC142054, MGC142060, MGC4120817, MGC78549, NOC
Gene Description
CCR4 carbon catabolite repression 4-like (S. cerevisiae)
Omim ID
608468Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbon catabolite repression 4 (CCR4). The mRNA abundance of a similar gene in mouse has been shown to exhibit circadian rhythmicity, which suggests a role for this protein in clock function or as a circadian clock effector. [provided by RefSeq
Other Designations
CCR4 carbon catabolite repression 4-like|CCR4-like (carbon catabolite repression 4, S.cerevisiae)|nocturnin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com