BAMBI monoclonal antibody (M01), clone 3C1-1D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant BAMBI.
Immunogen
BAMBI (AAH19252, 1 a.a. ~ 260 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLTLVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (95)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.34 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BAMBI expression in transfected 293T cell line by BAMBI monoclonal antibody (M01), clone 3C1-1D1.
Lane 1: BAMBI transfected lysate(29.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BAMBI is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — BAMBI
Entrez GeneID
25805GeneBank Accession#
BC019252Protein Accession#
AAH19252Gene Name
BAMBI
Gene Alias
NMA
Gene Description
BMP and activin membrane-bound inhibitor homolog (Xenopus laevis)
Omim ID
604444Gene Ontology
HyperlinkGene Summary
This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis. [provided by RefSeq
Other Designations
BMP and activin membrane-bound inhibitor|OTTHUMP00000019384|non-metastatic gene A protein|putative transmembrane protein
-
Interactome
-
Disease
-
Publication Reference
-
BMP and Activin Membrane Bound Inhibitor Regulates the Extracellular Matrix in the Trabecular Meshwork.
Hernandez H, Millar JC, Curry SM, Clark AF, McDowell CM.
Investigative Ophthalmology & Visual Science 2018 Apr; 59(5):2154.
Application:IF, IHC-P, Mouse, Mouse eye.
-
Human trabecular meshwork cells express BMP antagonist mRNAs and proteins.
Tovar-Vidales T, Fitzgerald AM, Clark AF.
Experimental Eye Research 2016 Jun; 147:156.
Application:WB-Ce, Human, Trabecular meshwork cells.
-
Adiponectin induces the transforming growth factor decoy receptor BAMBI in human hepatocytes.
Wanninger J, Neumeier M, Bauer S, Weiss TS, Eisinger K, Walter R, Dorn C, Hellerbrand C, Schaffler A, Buechler C.
FEBS Letters 2011 May; 585(9):1338.
Application:WB-Ce, Human, Human hepatocytes, Human hepatic stellate cells, Human liver cancer.
-
BAMBI Is Expressed in Endothelial Cells and Is Regulated by Lysosomal/Autolysosomal Degradation.
Xavier S, Gilbert V, Rastaldi MP, Krick S, Kollins D, Reddy A, Bottinger E, Cohen CD, Schlondorff D.
PLoS One 2010 Sep; 5(9):e12995.
Application:IF, IHC-Fr, Human, Kidneys.
-
BAMBI is overexpressed in ovarian cancer and co-translocates with Smads into the nucleus upon TGF-ss treatment.
Pils D, Wittinger M, Petz M, Gugerell A, Gregor W, Alfanz A, Horvat R, Braicu EI, Sehouli J, Zeillinger R, Mikulits W, Krainer M.
Gynecologic Oncology 2010 May; 117(2):189.
Application:ICC, IHC-P, WB-Tr, Human , H134, MDAH 2774, SKOV3 cells, Ovarian tumors.
-
BAMBI (bone morphogenetic protein and activin membrane-bound inhibitor) reveals the involvement of the transforming growth factor-beta family in pain modulation.
Tramullas M, Lantero A, Diaz A, Morchon N, Merino D, Villar A, Buscher D, Merino R, Hurle JM, Izpisua-Belmonte JC, Hurle MA.
Journal of Neuroscience 2010 Jan; 30(4):1502.
Application:IF, Mouse, Mouse spinal cords.
-
BMP and Activin Membrane Bound Inhibitor Regulates the Extracellular Matrix in the Trabecular Meshwork.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com