SPDEF monoclonal antibody (M01), clone 4A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SPDEF.
Immunogen
SPDEF (NP_036523, 92 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (86)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SPDEF expression in transfected 293T cell line by SPDEF monoclonal antibody (M01), clone 4A5.
Lane 1: SPDEF transfected lysate(37.518 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SPDEF is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SPDEF
Entrez GeneID
25803GeneBank Accession#
NM_012391Protein Accession#
NP_036523Gene Name
SPDEF
Gene Alias
PDEF, RP11-375E1__A.3, bA375E1.3
Gene Description
SAM pointed domain containing ets transcription factor
Omim ID
608144Gene Ontology
HyperlinkGene Summary
PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA (MIM 176820) expression.[supplied by OMIM
Other Designations
OTTHUMP00000016234|prostate epithelium-specific Ets transcription factor
-
Interactome
-
Publication Reference
-
Upregulation of SPDEF is associated with poor prognosis in prostate cancer.
Meiners J, Schulz K, Möller K, Höflmayer D, Burdelski C, Hube-Magg C, Simon R, Göbel C, Hinsch A, Reiswich V, Weidemann S, Izbicki JR, Sauter G, Jacobsen F, Möller-Koop C, Mandelkow T, Blessin NC, Lutz F, Viehweger F, Lennartz M, Fraune C, Heinzer H, Minner S, Bonk S, Huland H, Graefen M, Schlomm T, Büscheck F.
Oncology Letters 2019 Nov; 18(5):5107.
Application:IHC-P, Human, Human tissue microarray, Prostate cancer.
-
Upregulation of SPDEF is associated with poor prognosis in prostate cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com