QPCT purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human QPCT protein.
Immunogen
QPCT (NP_036545.1, 1 a.a. ~ 361 a.a) full-length human protein.
Sequence
MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (69)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
QPCT MaxPab polyclonal antibody. Western Blot analysis of QPCT expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of QPCT expression in transfected 293T cell line by QPCT MaxPab polyclonal antibody.
Lane 1: QPCT transfected lysate(39.71 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — QPCT
Entrez GeneID
25797GeneBank Accession#
NM_012413Protein Accession#
NP_036545.1Gene Name
QPCT
Gene Alias
GCT, QC
Gene Description
glutaminyl-peptide cyclotransferase
Omim ID
607065Gene Ontology
HyperlinkGene Summary
This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided by RefSeq
Other Designations
glutaminyl cyclase
-
Interactome
-
Disease
-
Publication Reference
-
Increased glutaminyl cyclase expression in peripheral blood of Alzheimer's disease patients.
Valenti MT, Bolognin S, Zanatta C, Donatelli L, Innamorati G, Pampanin M, Zanusso G, Zatta P, Dalle Carbonare L.
Journal of Alzheimer's Disease 2013 Feb; 34(1):263.
Application:WB, Human, Serum.
-
Glutaminyl Cyclase As a Diagnostic/Prognostic Indicator For Neurodegenrative Diseases.
Hans-Ulrich Demuth, Stephan Schilling, Martin Kleinschmidt, Jens-Ulrich Rahfeld, Astrid Kehlen, Monique Haegele.
United States Patent Application Publication 2010 Feb; [Epub].
Application:WB-Ti, Human, Brain.
-
Increased glutaminyl cyclase expression in peripheral blood of Alzheimer's disease patients.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com