QPCT polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant QPCT.
Immunogen
QPCT (NP_036545, 262 a.a. ~ 359 a.a) partial recombinant protein with GST tag.
Sequence
PNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (69)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.89 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — QPCT
Entrez GeneID
25797GeneBank Accession#
NM_012413Protein Accession#
NP_036545Gene Name
QPCT
Gene Alias
GCT, QC
Gene Description
glutaminyl-peptide cyclotransferase
Omim ID
607065Gene Ontology
HyperlinkGene Summary
This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided by RefSeq
Other Designations
glutaminyl cyclase
-
Interactome
-
Disease
-
Publication Reference
-
Glutaminyl Cyclase in Human Cortex: Correlation with (pGlu)-Amyloid-β Load and Cognitive Decline in Alzheimers Disease.
Morawski M, Schilling S, Kreuzberger M, Waniek A, Jager C, Koch B, Cynis H, Kehlen A, Arendt T, Hartlage-Rubsamen M, Demuth HU, Rossner S.
Journal of Alzheimer's Disease 2014 Jan; 39(2):385.
Application:IHC, Human, Brain.
-
Inhibition of Glutaminyl Cyclase Attenuates Cell Migration Modulated by Monocyte Chemoattractant Proteins.
Chen YL, Huang KF, Kuo WC, Lo YC, Lee YM, Wang AH.
The Biochemical Journal 2012 Mar; 442(2):403.
Application:WB, Human, U937 cells.
-
Glutaminyl cyclase contributes to the formation of focal and diffuse pyroglutamate (pGlu)-A?] deposits in hippocampus via distinct cellular mechanisms.
Hartlage-Rubsamen M, Morawski M, Waniek A, Jager C, Zeitschel U, Koch B, Cynis H, Schilling S, Schliebs R, Demuth HU, RoBner S.
Acta Neuropathologica 2011 Jun; 121(6):705.
Application:IHC, Human, Brain.
-
Distinct glutaminyl cyclase expression in Edinger-Westphal nucleus, locus coeruleus and nucleus basalis Meynert contributes to pGlu-Abeta pathology in Alzheimer's disease.
Morawski M, Hartlage-Rubsamen M, Jager C, Waniek A, Schilling S, Schwab C, McGeer PL, Arendt T, Demuth HU, Rossner S.
Acta Neuropathologica 2010 Aug; 120(2):195.
Application:IHC, Human, Brain.
-
Glutaminyl Cyclase in Human Cortex: Correlation with (pGlu)-Amyloid-β Load and Cognitive Decline in Alzheimers Disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com