RAD54B purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RAD54B MaxPab rabbit polyclonal antibody. Western Blot analysis of RAD54B expression in human stomach.
Western Blot (Transfected lysate)
Western Blot analysis of RAD54B expression in transfected 293T cell line (H00025788-T02) by RAD54B MaxPab polyclonal antibody.
Lane 1: RAD54B transfected lysate(18.60 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RAD54B protein.
Immunogen
RAD54B (AAH33710.2, 1 a.a. ~ 158 a.a) full-length human protein.
Sequence
MLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (31)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RAD54B MaxPab rabbit polyclonal antibody. Western Blot analysis of RAD54B expression in human stomach.Western Blot (Transfected lysate)
Western Blot analysis of RAD54B expression in transfected 293T cell line (H00025788-T02) by RAD54B MaxPab polyclonal antibody.
Lane 1: RAD54B transfected lysate(18.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RAD54B
Entrez GeneID
25788GeneBank Accession#
BC033710Protein Accession#
AAH33710.2Gene Name
RAD54B
Gene Alias
FSBP, RDH54
Gene Description
RAD54 homolog B (S. cerevisiae)
Omim ID
604289Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer. [provided by RefSeq
Other Designations
Fibrinogen silencer-binding protein|RAD54 homolog B|RAD54, S. cerevisiae, homolog of, B|fibrinogen silencer binding protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com