Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAD54B MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00025788-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RAD54B protein.
  • Immunogen:
  • RAD54B (AAH33710, 1 a.a. ~ 158 a.a) full-length human protein.
  • Sequence:
  • MLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RAD54B expression in transfected 293T cell line (H00025788-T01) by RAD54B MaxPab polyclonal antibody.

    Lane 1: RAD54B transfected lysate(17.38 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • RAD54B
  • Gene Alias:
  • FSBP,RDH54
  • Gene Description:
  • RAD54 homolog B (S. cerevisiae)
  • Gene Summary:
  • The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer. [provided by RefSeq
  • Other Designations:
  • Fibrinogen silencer-binding protein,RAD54 homolog B,RAD54, S. cerevisiae, homolog of, B,fibrinogen silencer binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook