Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DSTYK monoclonal antibody (M08), clone 4D5

  • Catalog # : H00025778-M08
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant DSTYK.
  • Immunogen:
  • DSTYK (NP_056190, 80 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • DVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQDCNVKCQLLNLLLGVQVLPTTKLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAHQGNWETIPE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00025778-M08
    Western Blot detection against Immunogen (37.84 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DSTYK expression in transfected 293T cell line by DSTYK monoclonal antibody (M08), clone 4D5.

    Lane 1: DSTYK transfected lysate (Predicted MW: 66.4 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DSTYK
  • Gene Alias:
  • DustyPK,HDCMD38P,KIAA0472,RIP5,RIPK5
  • Gene Description:
  • dual serine/threonine and tyrosine protein kinase
  • Gene Summary:
  • This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. It is thought to function as a regulator of cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000035175,OTTHUMP00000035299,dusty protein kinase,receptor interacting protein 5,receptor interacting protein kinase 5
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook