Product Browser

Last updated: 2017/8/13
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NAT6 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00024142-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human NAT6 protein.
  • Immunogen:
  • NAT6 (AAH04483, 23 a.a. ~ 308 a.a) full-length human protein.
  • Sequence:
  • MELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTGLTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPPKSLLETQYQNVRGRPIFWMEKDI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NAT6 expression in transfected 293T cell line (H00024142-T01) by NAT6 MaxPab polyclonal antibody.

    Lane 1: NAT6 transfected lysate(33.99 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • NAT6
  • Gene Alias:
  • FUS-2,FUS2
  • Gene Description:
  • N-acetyltransferase 6 (GCN5-related)
  • Other Designations:
  • putative tumor suppressor
  • RSS
  • YouTube
  • Linkedin
  • Facebook