Product Browser

Last updated: 2017/3/19
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FTSJ1 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00024140-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FTSJ1 protein.
  • Immunogen:
  • FTSJ1 (AAH23584, 1 a.a. ~ 329 a.a) full-length human protein.
  • Sequence:
  • MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTDLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FTSJ1 expression in transfected 293T cell line (H00024140-T01) by FTSJ1 MaxPab polyclonal antibody.

    Lane 1: FTSJ1 transfected lysate(36.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • FTSJ1
  • Gene Alias:
  • CDLIV,JM23,MRX44,MRX9,SPB1,TRM7
  • Gene Description:
  • FtsJ homolog 1 (E. coli)
  • Gene Summary:
  • The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • FtsJ homolog 1,OTTHUMP00000025795,OTTHUMP00000025796,cell division protein,rRNA (uridine-2'-O-)-methyltransferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook