FKBP8 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FKBP8 full-length ORF ( AAH09966, 1 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGPVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRRRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
64.79
Interspecies Antigen Sequence
Mouse (90); Rat (91)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FKBP8
Entrez GeneID
23770GeneBank Accession#
BC009966Protein Accession#
AAH09966Gene Name
FKBP8
Gene Alias
FKBP38, FKBPr38
Gene Description
FK506 binding protein 8, 38kDa
Omim ID
604840Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, this encoded protein does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function. [provided by RefSeq
Other Designations
FK506 binding protein 8 (38kD)|FK506-binding protein 8|FK506-binding protein 8 (38kD)
-
Interactome
-
Publication Reference
-
Macrocycles that inhibit the binding between heat shock protein 90 and TPR-containing proteins.
Ardi V, Alexander LD, Johnson VA, McAlpine SR.
ACS Chemical Biology 2011 Dec; 6(12):1357.
Application:Func, PI, Recombinant proteins.
-
Macrocycles that inhibit the binding between heat shock protein 90 and TPR-containing proteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com