Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FLRT1 (Human) Recombinant Protein (P01)

  • Catalog # : H00023769-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FLRT1 full-length ORF ( AAH18370, 1 a.a. - 674 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MVVAHPTATATTTPTATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLPLAGIIGGAVALVFLFLVLGAICWYVHQAGELLTRERAYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKATHTIGYGTTRGYRDGGIPDIDYSYT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 99.88
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023769-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • FLRT1
  • Gene Alias:
  • MGC21624
  • Gene Description:
  • fibronectin leucine rich transmembrane protein 1
  • Gene Summary:
  • This gene encodes a member of the fibronectin leucine rich transmembrane protein (FLRT) family. The family members may function in cell adhesion and/or receptor signalling. Their protein structures resemble small leucine-rich proteoglycans found in the extracellular matrix. The encoded protein shares sequence similarity with two other family members, FLRT2 and FLRT3. This gene is expressed in kidney and brain. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook