Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PITPNB polyclonal antibody (A01)

  • Catalog # : H00023760-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PITPNB.
  • Immunogen:
  • PITPNB (NP_036531, 181 a.a. ~ 271 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023760-A01
    Western Blot detection against Immunogen (36.12 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PITPNB
  • Gene Alias:
  • PI-TP-beta,PtdInsTP,VIB1B
  • Gene Description:
  • phosphatidylinositol transfer protein, beta
  • Gene Summary:
  • The protein encoded by this gene is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. [provided by RefSeq
  • Other Designations:
  • PtdIns transfer protein beta,phosphotidylinositol transfer protein, beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook