Product Browser

Last updated: 2017/5/21
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CRI1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00023741-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CRI1 protein.
  • Immunogen:
  • CRI1 (NP_055150.1, 1 a.a. ~ 187 a.a) full-length human protein.
  • Sequence:
  • MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of EID1 expression in transfected 293T cell line (H00023741-T01) by EID1 MaxPab polyclonal antibody.

    Lane 1: CRI1 transfected lysate(20.57 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • EID1
  • Gene Alias:
  • C15orf3,CRI1,EID-1,IRO45620,MGC138883,MGC138884,PNAS-22,PTD014,RBP21
  • Gene Description:
  • EP300 interacting inhibitor of differentiation 1
  • Other Designations:
  • CREBBP/EP300 inhibitor 1,CREBBP/EP300 inhibitory protein 1,NB4 apoptosis related protein,Rb- and p300-binding protein EID-1,retinoblastoma protein-associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook