Product Browser

Last updated: 2017/5/28
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CRI1 polyclonal antibody (A01)

  • Catalog # : H00023741-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CRI1.
  • Immunogen:
  • CRI1 (NP_055150, 116 a.a. ~ 187 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023741-A01
    Western Blot detection against Immunogen (34.03 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • EID1
  • Gene Alias:
  • C15orf3,CRI1,EID-1,IRO45620,MGC138883,MGC138884,PNAS-22,PTD014,RBP21
  • Gene Description:
  • EP300 interacting inhibitor of differentiation 1
  • Other Designations:
  • CREBBP/EP300 inhibitor 1,CREBBP/EP300 inhibitory protein 1,NB4 apoptosis related protein,Rb- and p300-binding protein EID-1,retinoblastoma protein-associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook