Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CADM1 monoclonal antibody (M02), clone 1B5

  • Catalog # : H00023705-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CADM1.
  • Immunogen:
  • CADM1 (NP_055148, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • IQRDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023705-M02
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged CADM1 is 0.1 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • CADM1
  • Gene Alias:
  • BL2,DKFZp686F1789,IGSF4,IGSF4A,MGC149785,MGC51880,NECL2,Necl-2,RA175,ST17,SYNCAM,TSLC1,sTSLC-1,sgIGSF,synCAM1
  • Gene Description:
  • cell adhesion molecule 1
  • Other Designations:
  • TSLC1/Nectin-like 2/IGSF4,immunoglobulin superfamily, member 4,immunoglobulin superfamily, member 4D,nectin-like 2,nectin-like protein 2,tumor suppressor in lung cancer 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook