RAB38 monoclonal antibody (M02), clone 7F1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RAB38 monoclonal antibody (M02), clone 7F1 Western Blot analysis of RAB38 expression in A-431 ( Cat # L015V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB38 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAB38.
Immunogen
RAB38 (NP_071732, 115 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAB38 monoclonal antibody (M02), clone 7F1 Western Blot analysis of RAB38 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB38 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — RAB38
-
Interactome
-
Publication Reference
-
miRNA Expression Profiling in Melanocytes and Melanoma Cell Lines Reveals miRNAs Associated with Formation and Progression of Malignant Melanoma.
Mueller DW, Rehli M, Bosserhoff AK.
The Journal of Investigative Dermatology 2009 Jul; 129(7):1740.
Application：WB-Ce, WB-Ti, Human, Melanocytes, Melanoma cells, Melanoma tissue samples.
-
miRNA Expression Profiling in Melanocytes and Melanoma Cell Lines Reveals miRNAs Associated with Formation and Progression of Malignant Melanoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com