Product Browser

Last updated: 2016/12/11
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LYPLA3 monoclonal antibody (M01), clone 3B11

  • Catalog # : H00023659-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant LYPLA3.
  • Immunogen:
  • LYPLA3 (NP_036452, 314 a.a. ~ 412 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • TEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023659-M01
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • LYPLA3 monoclonal antibody (M01), clone 3B11 Western Blot analysis of LYPLA3 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • LYPLA3 monoclonal antibody (M01), clone 3B11. Western Blot analysis of LYPLA3 expression in PC-12(Cat # L012V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • LYPLA3 monoclonal antibody (M01), clone 3B11. Western Blot analysis of LYPLA3 expression in Raw 264.7(Cat # L024V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • LYPLA3 monoclonal antibody (M01), clone 3B11. Western Blot analysis of LYPLA3 expression in NIH/3T3(Cat # L018V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PLA2G15 expression in transfected 293T cell line by LYPLA3 monoclonal antibody (M01), clone 3B11.

    Lane 1: PLA2G15 transfected lysate(46.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PLA2G15
  • Gene Alias:
  • ACS,DKFZp564A0122,GXVPLA2,LLPL,LPLA2,LYPLA3
  • Gene Description:
  • phospholipase A2, group XV
  • Gene Summary:
  • Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. This enzyme is present in the plasma and thought to be associated with high-density lipoprotein. A later paper contradicts the function of this gene. It demonstrates that this gene encodes a lysosomal enzyme instead of a lysophospholipase and has both calcium-independent phospholipase A2 and transacylase activities. [provided by RefSeq
  • Other Designations:
  • 1-O-acylceramide synthase,LCAT-like lysophospholipase,lysophospholipase 3 (lysosomal phospholipase A2),lysosomal phospholipase A2
  • RSS
  • YouTube
  • Linkedin
  • Facebook