LYPLA3 monoclonal antibody (M01), clone 3B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
LYPLA3 monoclonal antibody (M01), clone 3B11. Western Blot analysis of LYPLA3 expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
LYPLA3 monoclonal antibody (M01), clone 3B11. Western Blot analysis of LYPLA3 expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Cell lysate)
LYPLA3 monoclonal antibody (M01), clone 3B11. Western Blot analysis of LYPLA3 expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
LYPLA3 monoclonal antibody (M01), clone 3B11 Western Blot analysis of LYPLA3 expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of PLA2G15 expression in transfected 293T cell line by LYPLA3 monoclonal antibody (M01), clone 3B11.
Lane 1: PLA2G15 transfected lysate(46.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LYPLA3.
Immunogen
LYPLA3 (NP_036452, 314 a.a. ~ 412 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LYPLA3 monoclonal antibody (M01), clone 3B11. Western Blot analysis of LYPLA3 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
LYPLA3 monoclonal antibody (M01), clone 3B11. Western Blot analysis of LYPLA3 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
LYPLA3 monoclonal antibody (M01), clone 3B11. Western Blot analysis of LYPLA3 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
LYPLA3 monoclonal antibody (M01), clone 3B11 Western Blot analysis of LYPLA3 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PLA2G15 expression in transfected 293T cell line by LYPLA3 monoclonal antibody (M01), clone 3B11.
Lane 1: PLA2G15 transfected lysate(46.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — PLA2G15
Entrez GeneID
23659GeneBank Accession#
NM_012320Protein Accession#
NP_036452Gene Name
PLA2G15
Gene Alias
ACS, DKFZp564A0122, GXVPLA2, LLPL, LPLA2, LYPLA3
Gene Description
phospholipase A2, group XV
Omim ID
609362Gene Ontology
HyperlinkGene Summary
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. This enzyme is present in the plasma and thought to be associated with high-density lipoprotein. A later paper contradicts the function of this gene. It demonstrates that this gene encodes a lysosomal enzyme instead of a lysophospholipase and has both calcium-independent phospholipase A2 and transacylase activities. [provided by RefSeq
Other Designations
1-O-acylceramide synthase|LCAT-like lysophospholipase|lysophospholipase 3 (lysosomal phospholipase A2)|lysosomal phospholipase A2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com