TRIM29 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TRIM29 MaxPab polyclonal antibody. Western Blot analysis of TRIM29 expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of TRIM29 expression in transfected 293T cell line (H00023650-T01) by TRIM29 MaxPab polyclonal antibody.
Lane 1: TRIM29 transfected lysate(64.68 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TRIM29 protein.
Immunogen
TRIM29 (NP_036233.2, 1 a.a. ~ 588 a.a) full-length human protein.
Sequence
MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSALKPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVTFAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVCMRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TRIM29 MaxPab polyclonal antibody. Western Blot analysis of TRIM29 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of TRIM29 expression in transfected 293T cell line (H00023650-T01) by TRIM29 MaxPab polyclonal antibody.
Lane 1: TRIM29 transfected lysate(64.68 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TRIM29
Entrez GeneID
23650GeneBank Accession#
NM_012101.3Protein Accession#
NP_036233.2Gene Name
TRIM29
Gene Alias
ATDC, FLJ36085
Gene Description
tripartite motif-containing 29
Omim ID
610658Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the TRIM protein family. It has multiple zinc finger motifs and a leucine zipper motif. It has been proposed to form homo- or heterodimers which are involved in nucleic acid binding. Thus, it may act as a transcriptional regulatory factor involved in carcinogenesis and/or differentiation. It may also function in the suppression of radiosensitivity since it is associated with ataxia telangiectasia phenotype. [provided by RefSeq
Other Designations
ataxia-telangiectasia group D-associated protein|tripartite motif protein TRIM29
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com