LY96 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
LY96 MaxPab rabbit polyclonal antibody. Western Blot analysis of LY96 expression in mouse spleen.
Western Blot (Transfected lysate)
Western Blot analysis of LY96 expression in transfected 293T cell line (H00023643-T01) by LY96 MaxPab polyclonal antibody.
Lane 1: LY96 transfected lysate(18.40 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human LY96 protein.
Immunogen
LY96 (NP_056179.1, 1 a.a. ~ 160 a.a) full-length human protein.
Sequence
MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (64)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
LY96 MaxPab rabbit polyclonal antibody. Western Blot analysis of LY96 expression in mouse spleen.Western Blot (Transfected lysate)
Western Blot analysis of LY96 expression in transfected 293T cell line (H00023643-T01) by LY96 MaxPab polyclonal antibody.
Lane 1: LY96 transfected lysate(18.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — LY96
Entrez GeneID
23643GeneBank Accession#
NM_015364Protein Accession#
NP_056179.1Gene Name
LY96
Gene Alias
MD-2, MD2
Gene Description
lymphocyte antigen 96
Omim ID
605243Gene Ontology
HyperlinkGene Summary
The MD-2 protein appears to associate with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. [provided by RefSeq
Other Designations
MD-2 protein|myeloid differentiation protein-2
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com