LDOC1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human LDOC1 partial ORF ( NP_036449, 19 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.96
Interspecies Antigen Sequence
Mouse (73)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — LDOC1
Entrez GeneID
23641GeneBank Accession#
NM_012317Protein Accession#
NP_036449Gene Name
LDOC1
Gene Alias
BCUR1, Mar7, Mart7
Gene Description
leucine zipper, down-regulated in cancer 1
Omim ID
300402Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB). The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers. [provided by RefSeq
Other Designations
OTTHUMP00000024174|breast cancer, up-regulated 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com