LDOC1 monoclonal antibody (M13), clone 3E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant LDOC1.
Immunogen
LDOC1 (NP_036449.1, 1 a.a. ~ 146 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LDOC1 expression in transfected 293T cell line by LDOC1 monoclonal antibody (M13), clone 3E5.
Lane 1: LDOC1 transfected lysate(17 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LDOC1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — LDOC1
Entrez GeneID
23641GeneBank Accession#
NM_012317.2Protein Accession#
NP_036449.1Gene Name
LDOC1
Gene Alias
BCUR1, Mar7, Mart7
Gene Description
leucine zipper, down-regulated in cancer 1
Omim ID
300402Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB). The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers. [provided by RefSeq
Other Designations
OTTHUMP00000024174|breast cancer, up-regulated 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com