CA14 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CA14 MaxPab polyclonal antibody. Western Blot analysis of CA14 expression in human liver.
Western Blot (Cell lysate)
CA14 MaxPab polyclonal antibody. Western Blot analysis of CA14 expression in K-562.
Western Blot (Transfected lysate)
Western Blot analysis of CA14 expression in transfected 293T cell line (H00023632-T01) by CA14 MaxPab polyclonal antibody.
Lane 1: CA14 transfected lysate(37.07 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CA14 protein.
Immunogen
CA14 (NP_036245.1, 1 a.a. ~ 337 a.a) full-length human protein.
Sequence
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CA14 MaxPab polyclonal antibody. Western Blot analysis of CA14 expression in human liver.Western Blot (Cell lysate)
CA14 MaxPab polyclonal antibody. Western Blot analysis of CA14 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of CA14 expression in transfected 293T cell line (H00023632-T01) by CA14 MaxPab polyclonal antibody.
Lane 1: CA14 transfected lysate(37.07 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CA14
Entrez GeneID
23632GeneBank Accession#
NM_012113.1Protein Accession#
NP_036245.1Gene Name
CA14
Gene Alias
-
Gene Description
carbonic anhydrase XIV
Omim ID
604832Gene Ontology
HyperlinkGene Summary
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA XIV is predicted to be a type I membrane protein and shares highest sequence similarity with the other transmembrane CA isoform, CA XII; however, they have different patterns of tissue-specific expression and thus may play different physiologic roles. [provided by RefSeq
Other Designations
OTTHUMP00000014540|carbonic dehydratase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Rest interval duration does not influence adaptations in acid/base transport proteins following 10 weeks of sprint-interval training in active women.
McGinley C, Bishop DJ.
American Journal of Physiology. Regulatory, Integrative and Comparative Physiology 2017 May; 312(5):R702.
Application：WB, Human, Human muscle biopsies.
-
Rest interval duration does not influence adaptations in acid/base transport proteins following 10 weeks of sprint-interval training in active women.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com