Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRND (Human) Recombinant Protein (P01)

  • Catalog # : H00023627-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRND full-length ORF ( AAH43644.1, 27 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLMVK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.24
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023627-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PRND
  • Gene Alias:
  • DOPPEL,DPL,MGC41841,PrPLP,dJ1068H6.4
  • Gene Description:
  • prion protein 2 (dublet)
  • Gene Summary:
  • This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030169,prion gene complex, downstream,prion-like protein doppel
  • RSS
  • YouTube
  • Linkedin
  • Facebook