SPO11 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SPO11 partial ORF ( NP_036576, 291 a.a. - 395 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
YGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGW
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.29
Interspecies Antigen Sequence
Mouse (73); Rat (80)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SPO11
Entrez GeneID
23626GeneBank Accession#
NM_012444Protein Accession#
NP_036576Gene Name
SPO11
Gene Alias
MGC39953
Gene Description
SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)
Omim ID
605114Gene Ontology
HyperlinkGene Summary
Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. The protein encoded by this gene is similar in sequence and conserved features to the yeast meiotic recombination protein. The encoded protein belongs to the TOP6A protein family. Several transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been described. [provided by RefSeq
Other Designations
OTTHUMP00000031360|OTTHUMP00000031361|SPO11 meiotic protein covalently bound to DSB-like|SPO11, meiotic protein covalently bound to DSB-like|meiotic recombination protein SPO11
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com