SPO11 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SPO11 protein.
Immunogen
SPO11 (NP_937998, 1 a.a. ~ 358 a.a) full-length human protein.
Sequence
MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASRFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (80)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SPO11 expression in transfected 293T cell line (H00023626-T01) by SPO11 MaxPab polyclonal antibody.
Lane 1: SPO11 transfected lysate(39.38 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SPO11
Entrez GeneID
23626GeneBank Accession#
NM_198265Protein Accession#
NP_937998Gene Name
SPO11
Gene Alias
MGC39953
Gene Description
SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)
Omim ID
605114Gene Ontology
HyperlinkGene Summary
Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. The protein encoded by this gene is similar in sequence and conserved features to the yeast meiotic recombination protein. The encoded protein belongs to the TOP6A protein family. Several transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been described. [provided by RefSeq
Other Designations
OTTHUMP00000031360|OTTHUMP00000031361|SPO11 meiotic protein covalently bound to DSB-like|SPO11, meiotic protein covalently bound to DSB-like|meiotic recombination protein SPO11
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com