Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RUSC1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00023623-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RUSC1 protein.
  • Immunogen:
  • RUSC1 (NP_055143.2, 1 a.a. ~ 433 a.a) full-length human protein.
  • Sequence:
  • MAEAQSGTGQLQEQKKGLLIAVSVSVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSSTRSLGTLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFEHHHHLPLGPPQAPAPPGPPPALQQTMQAMLHFGGRLAQSLRGTSKEAASDPSDSPNLPTPGSWWEQLTQASRVYASGGTEGFPLSRWAPGRHGTAAEEGAQERPLPTDEMAPGRGLWLGRLFGVPGGPAENENGALKSRRPSSWLPPTVSVLALVKRGAPPEMPSPQELEASAPRMVQTHRAVRALCDHTAARPDQLSFRRGEVLRVITTVDEDWLRCGRDGMEGLVPVGYTSLVL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RUSC1 expression in transfected 293T cell line (H00023623-T01) by RUSC1 MaxPab polyclonal antibody.

    Lane1:RUSC1 transfected lysate(47.63 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • RUSC1
  • Gene Alias:
  • DKFZp761A1822,NESCA
  • Gene Description:
  • RUN and SH3 domain containing 1
  • Other Designations:
  • OTTHUMP00000015809,OTTHUMP00000015893,OTTHUMP00000015894,OTTHUMP00000015895,OTTHUMP00000015896,new molecule containing SH3 at the carboxy-terminus
  • RSS
  • YouTube
  • Linkedin
  • Facebook