Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZMYND8 (Human) Recombinant Protein (Q01)

  • Catalog # : H00023613-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ZMYND8 partial ORF ( NP_898869, 601 a.a. - 698 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023613-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ZMYND8
  • Gene Alias:
  • MGC31836,PRKCBP1,PRO2893,RACK7
  • Gene Description:
  • zinc finger, MYND-type containing 8
  • Gene Summary:
  • The protein encoded by this gene is a receptor for activated C-kinase (RACK) protein. The encoded protein has been shown to bind in vitro to activated protein kinase C beta I. In addition, this protein is a cutaneous T-cell lymphoma-associated antigen. Finally, the protein contains a bromodomain and two zinc fingers, and is thought to be a transcriptional regulator. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CTCL tumor antigen se14-3,cutaneous T-cell lymphoma associated antigen se14-3,predicted protein of HQ2893,protein kinase C binding protein 1,zinc finger MYND domain containing protein 8
  • RSS
  • YouTube
  • Linkedin
  • Facebook