ZMYND8 monoclonal antibody (M01), clone 5B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ZMYND8 monoclonal antibody (M01), clone 5B12 Western Blot analysis of ZMYND8 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ZMYND8 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 0.25 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZMYND8 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZMYND8.
Immunogen
ZMYND8 (NP_898869, 601 a.a. ~ 698 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (76)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ZMYND8 monoclonal antibody (M01), clone 5B12 Western Blot analysis of ZMYND8 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ZMYND8 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 0.25 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZMYND8 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — ZMYND8
Entrez GeneID
23613GeneBank Accession#
NM_183048Protein Accession#
NP_898869Gene Name
ZMYND8
Gene Alias
MGC31836, PRKCBP1, PRO2893, RACK7
Gene Description
zinc finger, MYND-type containing 8
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a receptor for activated C-kinase (RACK) protein. The encoded protein has been shown to bind in vitro to activated protein kinase C beta I. In addition, this protein is a cutaneous T-cell lymphoma-associated antigen. Finally, the protein contains a bromodomain and two zinc fingers, and is thought to be a transcriptional regulator. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CTCL tumor antigen se14-3|cutaneous T-cell lymphoma associated antigen se14-3|predicted protein of HQ2893|protein kinase C binding protein 1|zinc finger MYND domain containing protein 8
-
Interactome
-
Disease
-
Publication Reference
-
Physical and functional interactions between the histone H3K4 demethylase KDM5A and the nucleosome remodeling and deacetylase (NuRD) complex.
Nishibuchi G, Shibata Y, Hayakawa T, Hayakawa N, Ohtani Y, Sinmyozu K, Tagami H, Nakayama J.
The Journal of Biological Chemistry 2014 Oct; 289(42):28956.
Application：WB-Ce, Human, HEK293T, HeLa cells.
-
Physical and functional interactions between the histone H3K4 demethylase KDM5A and the nucleosome remodeling and deacetylase (NuRD) complex.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com