MKRN2 monoclonal antibody (M01), clone 5F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MKRN2.
Immunogen
MKRN2 (NP_054879, 317 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MKRN2 monoclonal antibody (M01), clone 5F8 Western Blot analysis of MKRN2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of MKRN2 expression in transfected 293T cell line by MKRN2 monoclonal antibody (M01), clone 5F8.
Lane 1: MKRN2 transfected lysate(46.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MKRN2 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of MKRN2 over-expressed 293 cell line, cotransfected with MKRN2 Validated Chimera RNAi ( Cat # H00023609-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MKRN2 monoclonal antibody (M01), clone 5F8 (Cat # H00023609-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to MKRN2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MKRN2
Entrez GeneID
23609GeneBank Accession#
NM_014160Protein Accession#
NP_054879Gene Name
MKRN2
Gene Alias
HSPC070, RNF62
Gene Description
makorin ring finger protein 2
Omim ID
608426Gene Ontology
HyperlinkGene Summary
Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins (Gray et al., 2001 [PubMed 11597136]).[supplied by OMIM
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com