Product Browser

Last updated: 2017/5/21
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMUG1 polyclonal antibody (A01)

  • Catalog # : H00023583-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SMUG1.
  • Immunogen:
  • SMUG1 (NP_055126, 2 a.a. ~ 78 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023583-A01
    Western Blot detection against Immunogen (34.58 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SMUG1 polyclonal antibody (A01), Lot # 060608JCS1 Western Blot analysis of SMUG1 expression in SJCRH30 ( Cat # L027V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SMUG1
  • Gene Alias:
  • FDG,HMUDG,MGC104370,UNG3
  • Gene Description:
  • single-strand-selective monofunctional uracil-DNA glycosylase 1
  • Gene Summary:
  • SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.[supplied by OMIM
  • Other Designations:
  • single-strand selective monofunctional uracil DNA glycosylase
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook