CCNDBP1 monoclonal antibody (M02), clone 3B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CCNDBP1 expression in transfected 293T cell line by CCNDBP1 monoclonal antibody (M02), clone 3B7.
Lane 1: CCNDBP1 transfected lysate(40.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CCNDBP1 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CCNDBP1.
Immunogen
CCNDBP1 (NP_036274.2, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LVAENGKKDQVAQMADIVDISDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (77)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CCNDBP1 expression in transfected 293T cell line by CCNDBP1 monoclonal antibody (M02), clone 3B7.
Lane 1: CCNDBP1 transfected lysate(40.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CCNDBP1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — CCNDBP1
Entrez GeneID
23582GeneBank Accession#
NM_012142Protein Accession#
NP_036274.2Gene Name
CCNDBP1
Gene Alias
DIP1, GCIP
Gene Description
cyclin D-type binding-protein 1
Omim ID
607089Gene Ontology
HyperlinkGene Summary
This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells was reported to reduce the phosphorylation of Rb gene product by cyclin D-dependent protein kinase, and inhibit E2F1-mediated transcription activity. This protein was also found to interact with helix-loop-helix protein E12 and is thought to be a negative regulator of liver-specific gene expression. Several alternatively spliced variants have been found for this gene. [provided by RefSeq
Other Designations
D-type cyclin-interacting protein 1|HHM Protein|MAID protein|grap2 cyclin interacting protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com