CASP14 monoclonal antibody (M01), clone 4C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CASP14 monoclonal antibody (M01), clone 4C9 Western Blot analysis of CASP14 expression in MCF-7 ( Cat # L046V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CASP14 is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CASP14 on HeLa cell. [antibody concentration 15 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CASP14.
Immunogen
CASP14 (NP_036246, 133 a.a. ~ 242 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLYLQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71); Rat (72)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CASP14 monoclonal antibody (M01), clone 4C9 Western Blot analysis of CASP14 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CASP14 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CASP14 on HeLa cell. [antibody concentration 15 ug/ml] -
Gene Info — CASP14
Entrez GeneID
23581GeneBank Accession#
NM_012114Protein Accession#
NP_036246Gene Name
CASP14
Gene Alias
MGC119078, MGC119079
Gene Description
caspase 14, apoptosis-related cysteine peptidase
Omim ID
605848Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This caspase has been shown to be processed and activated by caspase 8 and caspase 10 in vitro, and by anti-Fas agonist antibody or TNF-related apoptosis inducing ligand in vivo. The expression and processing of this caspase may be involved in keratinocyte terminal differentiation, which is important for the formation of the skin barrier. [provided by RefSeq
Other Designations
apoptosis-related cysteine protease|caspase 14|caspase 14, apoptosis-related cysteine protease
-
Interactome
-
Disease
-
Publication Reference
-
Proximity Proteomics Has Potential for Extracellular Vesicle Identification.
Hisako Kaneda, Yui Ida, Ryusuke Kuwahara, Izumi Sato, Takanari Nakano, Haruhiko Tokuda, Tsuyoshi Sato, Takayuki Murakoshi, Koichi Honke, Norihiro Kotani.
Journal of Proteome Research 2021 Jul; 20(7):3519.
Application：Cap Ab, ELISA, Human, Fluorescein-labeled recombinant proteins, Human serum samples.
-
Proximity Proteomics Has Potential for Extracellular Vesicle Identification.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com