Product Browser

Last updated: 2017/8/13
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CASP14 polyclonal antibody (A01)

  • Catalog # : H00023581-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CASP14.
  • Immunogen:
  • CASP14 (NP_036246, 133 a.a. ~ 242 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLYLQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023581-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CASP14
  • Gene Alias:
  • MGC119078,MGC119079
  • Gene Description:
  • caspase 14, apoptosis-related cysteine peptidase
  • Gene Summary:
  • This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This caspase has been shown to be processed and activated by caspase 8 and caspase 10 in vitro, and by anti-Fas agonist antibody or TNF-related apoptosis inducing ligand in vivo. The expression and processing of this caspase may be involved in keratinocyte terminal differentiation, which is important for the formation of the skin barrier. [provided by RefSeq
  • Other Designations:
  • apoptosis-related cysteine protease,caspase 14,caspase 14, apoptosis-related cysteine protease
  • RSS
  • YouTube
  • Linkedin
  • Facebook