Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC42EP4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00023580-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDC42EP4 partial ORF ( NP_036253, 163 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFHIDLGPSMLGDVLSIM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.67
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023580-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CDC42EP4
  • Gene Alias:
  • BORG4,CEP4,KAIA1777,MGC17125,MGC3740
  • Gene Description:
  • CDC42 effector protein (Rho GTPase binding) 4
  • Gene Summary:
  • The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control. [provided by RefSeq
  • Other Designations:
  • Cdc42 effector protein 4,binder of Rho GTPases 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook