CDC42EP4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CDC42EP4 partial ORF ( NP_036253, 163 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFHIDLGPSMLGDVLSIM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.67
Interspecies Antigen Sequence
Mouse (78); Rat (77)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CDC42EP4
Entrez GeneID
23580GeneBank Accession#
NM_012121Protein Accession#
NP_036253Gene Name
CDC42EP4
Gene Alias
BORG4, CEP4, KAIA1777, MGC17125, MGC3740
Gene Description
CDC42 effector protein (Rho GTPase binding) 4
Omim ID
605468Gene Ontology
HyperlinkGene Summary
The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control. [provided by RefSeq
Other Designations
Cdc42 effector protein 4|binder of Rho GTPases 4
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com