ARL2BP monoclonal antibody (M03), clone 2G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ARL2BP expression in transfected 293T cell line by ARL2BP monoclonal antibody (M03), clone 2G6.
Lane 1: ARL2BP transfected lysate (Predicted MW: 18.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARL2BP is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (43.67 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ARL2BP.
Immunogen
ARL2BP (AAH03087, 1 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.67 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ARL2BP expression in transfected 293T cell line by ARL2BP monoclonal antibody (M03), clone 2G6.
Lane 1: ARL2BP transfected lysate (Predicted MW: 18.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARL2BP is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — ARL2BP
Entrez GeneID
23568GeneBank Accession#
BC003087Protein Accession#
AAH03087Gene Name
ARL2BP
Gene Alias
BART, BART1
Gene Description
ADP-ribosylation factor-like 2 binding protein
Gene Ontology
HyperlinkGene Summary
ADP-ribosylation factor (ARF)-like proteins (ARLs) comprise a functionally distinct group of the ARF family of RAS-related GTPases. The protein encoded by this gene binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. The lack of detectable membrane association of this protein or ARL2 upon activation of ARL2 is suggestive of actions distinct from those of the ARFs. This protein is considered to be the first ARL2-specific effector identified, due to its interaction with ARL2.GTP but lack of ARL2 GTPase-activating protein activity. [provided by RefSeq
Other Designations
Arf-like 2 binding protein BART1|binder of Arl Two|binder of Arl2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com