ZNF346 monoclonal antibody (M01), clone 2D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ZNF346 expression in transfected 293T cell line by ZNF346 monoclonal antibody (M01), clone 2D10.
Lane 1: ZNF346 transfected lysate(32.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF346 is approximately 0.3ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of ZNF346 over-expressed 293 cell line, cotransfected with ZNF346 Validated Chimera RNAi ( Cat # H00023567-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF346 monoclonal antibody (M01), clone 2D10 (Cat # H00023567-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZNF346.
Immunogen
ZNF346 (AAH07775, 133 a.a. ~ 232 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NQCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLADPAVTD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (81)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZNF346 expression in transfected 293T cell line by ZNF346 monoclonal antibody (M01), clone 2D10.
Lane 1: ZNF346 transfected lysate(32.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF346 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ZNF346 over-expressed 293 cell line, cotransfected with ZNF346 Validated Chimera RNAi ( Cat # H00023567-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF346 monoclonal antibody (M01), clone 2D10 (Cat # H00023567-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — ZNF346
Entrez GeneID
23567GeneBank Accession#
BC007775Protein Accession#
AAH07775Gene Name
ZNF346
Gene Alias
DKFZp547M223, JAZ, Zfp346
Gene Description
zinc finger protein 346
Omim ID
605308Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a nucleolar, zinc finger protein that preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids, rather than DNA alone. Mutational studies indicate that the zinc finger domains are not only essential for dsRNA binding, but are also required for its nucleolar localization. The encoded protein may be involved in cell growth and survival. [provided by RefSeq
Other Designations
double-stranded RNA-binding zinc finger protein JAZ
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com