CHST5 monoclonal antibody (M05), clone 2E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CHST5.
Immunogen
CHST5 (NP_036258.1, 310 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CHST5 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — CHST5
Entrez GeneID
23563GeneBank Accession#
NM_012126Protein Accession#
NP_036258.1Gene Name
CHST5
Gene Alias
FLJ22167, I-GlcNAc-6-ST, MGC74625
Gene Description
carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5
Omim ID
604817Gene Ontology
HyperlinkGene Summary
The carbohydrates of glycoconjugates are highly diverse structures with variation in monosaccharide composition, glycosidic linkage positions, and branching of chains. Further diversity is added by the covalent addition of sulfate moieties to particular hydroxyl groups and amino groups of saccharides. The sulfate modifications of glycoproteins can be extensive in amount and frequently occur at high density. They can have a profound effect on the physiochemical properties of the glycoconjugates, at least in part through the addition of negative charge. Carbohydrate sulfation plays a critical role in many biologic processes. CHST5 belongs to the GST family of sulfotransferases, which also includes CHST1 (MIM 603797), CHST2 (MIM 603798), CHST3 (MIM 603799), and LSST. These enzymes are 6-O-sulfotransferases, which add sulfate to C6 of galactose (Gal), N-acetylgalactosamine (GalNAc), or N-acetylglucosamine (GlcNAc) (Lee et al., 1999 [PubMed 10491328]).[supplied by OMIM
Other Designations
N-acetylglucosamine 6-O-sulfotransferase|OTTHUMP00000174950|intestinal GlcNAc-6-sulfotransferase
-
Interactome
-
Disease
-
Publication Reference
-
Galacto-oligosaccharides may directly enhance intestinal barrier function through the modulation of goblet cells.
Bhatia S, Prabhu PN, Benefiel AC, Miller MJ, Chow J, Davis SR, Gaskins HR.
Molecular Nutrition & Food Research 2015 Mar; 59(3):566.
Application:WB-Ce, Human, LS174T cells were treated with GOS for 96 h..
-
Galacto-oligosaccharides may directly enhance intestinal barrier function through the modulation of goblet cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com