CCRK monoclonal antibody (M13), clone 3E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CCRK expression in transfected 293T cell line by CCRK monoclonal antibody (M13), clone 3E11.
Lane 1: CCRK transfected lysate(30.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CCRK is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.88 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CCRK.
Immunogen
CCRK (AAH02655.1, 183 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.88 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CCRK expression in transfected 293T cell line by CCRK monoclonal antibody (M13), clone 3E11.
Lane 1: CCRK transfected lysate(30.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CCRK is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — CCRK
Entrez GeneID
23552GeneBank Accession#
BC002655Protein Accession#
AAH02655.1Gene Name
CCRK
Gene Alias
CDCH, p42
Gene Description
cell cycle related kinase
Omim ID
610076Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase activates CDK2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
CAK-kinase p42|CDK-activating kinase p42|OTTHUMP00000021607|OTTHUMP00000123392|OTTHUMP00000123393|cyclin-dependent protein kinase H|cyclin-kinase-activating kinase p42
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com