CCRK purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CCRK protein.
Immunogen
CCRK (AAH02655.1, 1 a.a. ~ 275 a.a) full-length human protein.
Sequence
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (86); Rat (86)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CCRK MaxPab rabbit polyclonal antibody. Western Blot analysis of CCRK expression in human kidney.Western Blot (Tissue lysate)
CCRK MaxPab rabbit polyclonal antibody. Western Blot analysis of CCRK expression in mouse liver.Western Blot (Cell lysate)
CCRK MaxPab rabbit polyclonal antibody. Western Blot analysis of CCRK expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of CCRK expression in transfected 293T cell line (H00023552-T02) by CCRK MaxPab polyclonal antibody.
Lane 1: CCRK transfected lysate(30.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CCRK
Entrez GeneID
23552GeneBank Accession#
BC002655.2Protein Accession#
AAH02655.1Gene Name
CCRK
Gene Alias
CDCH, p42
Gene Description
cell cycle related kinase
Omim ID
610076Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase activates CDK2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
CAK-kinase p42|CDK-activating kinase p42|OTTHUMP00000021607|OTTHUMP00000123392|OTTHUMP00000123393|cyclin-dependent protein kinase H|cyclin-kinase-activating kinase p42
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com